Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Microcin J25-processing protein mcjB (mcjB)

This Recombinant Escherichia coli Microcin J25-processing protein mcjB (mcjB) spans the amino acid sequence from region 1-208aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9X2V8

Expression Region

1-208aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Escherichia coli

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MIRYCLTSYREDLVILDIINDSFSIVPDAGSLLKERDKLLKEFPQLSYFFDSEYHIGSVSRNSDTSFLEERWFLPEPDKTLYKCSLFKRFILLLKVFYYSWNIEKKGMAWIFISNKKENRLYSLNEEHLIRKEISNLSIIFHLNIFKSDCLTYSYALKRILNSRNIDAHLVIGVRTQPFYSHSWVEVGGQVINDAPNMRDKLSVIAEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ribonuclease Inhibitor (RNH1) Mouse Monoclonal Antibody [Clone ID: AT1H23]
AM09083PU-N 100 µL

Ribonuclease Inhibitor (RNH1) Mouse Monoclonal Antibody [Clone ID: AT1H23]

Sign In for Pricing
View Details
Tylosin D
TRC-T947665-1MG 1 mg

Tylosin D

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 S-stable trimer Protein (C-6His)
PKSV030314-01 50 µg

Recombinant SARS-CoV-2 S-stable trimer Protein (C-6His)

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 S-stable trimer Protein (C-6His)
PKSV030314-02 500 µg

Recombinant SARS-CoV-2 S-stable trimer Protein (C-6His)

Sign In for Pricing
View Details
ALDH3A1 Rabbit Polyclonal Antibody
AP14687PU-N 400 µL

ALDH3A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KCNMB2 (NM_005832) Human Over-expression Lysate
LC401775 20 µg

KCNMB2 (NM_005832) Human Over-expression Lysate

Sign In for Pricing
View Details