Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Microcin J25-processing protein mcjB (mcjB)

This Recombinant Escherichia coli Microcin J25-processing protein mcjB (mcjB) spans the amino acid sequence from region 1-208aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q9X2V8

Expression Region

1-208aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Escherichia coli

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MIRYCLTSYREDLVILDIINDSFSIVPDAGSLLKERDKLLKEFPQLSYFFDSEYHIGSVSRNSDTSFLEERWFLPEPDKTLYKCSLFKRFILLLKVFYYSWNIEKKGMAWIFISNKKENRLYSLNEEHLIRKEISNLSIIFHLNIFKSDCLTYSYALKRILNSRNIDAHLVIGVRTQPFYSHSWVEVGGQVINDAPNMRDKLSVIAEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N- (2-Chlorotrityl resin) -L-isoleucine benzotriazolyl ester
sc-472045 1 g

N- (2-Chlorotrityl resin) -L-isoleucine benzotriazolyl ester

Sign In for Pricing
View Details
FGF22 Protein Vector (Human) (pPM-C-His)
PV078352 500 ng

FGF22 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Sodium chloride pure EP, USP (pharma grade)
LC-4524.1 1 Kg

Sodium chloride pure EP, USP (pharma grade)

Sign In for Pricing
View Details
Canine Astrotactin 1 (ASTN1) ELISA kit
GTR10433163 96 Well

Canine Astrotactin 1 (ASTN1) ELISA kit

Sign In for Pricing
View Details
Rat Monoclonal S100A8 Antibody (63N13G5)
NBP2-27067SS 0.025 mg

Rat Monoclonal S100A8 Antibody (63N13G5)

Sign In for Pricing
View Details
Mouse Monoclonal Neurofibromin 1 Antibody (McNFn27a)
NB300-153 0.2 mL

Mouse Monoclonal Neurofibromin 1 Antibody (McNFn27a)

Sign In for Pricing
View Details