Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Cytolethal distending toxin subunit C (cdtC)

This Recombinant Escherichia coli Cytolethal distending toxin subunit C (cdtC) spans the amino acid sequence from region 16-181aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CDT C

UniProt

Q46670

Expression Region

16-181aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Escherichia coli

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CSSSQDSANNQIDELGKENNSLFTFRNIQSGLMIHNGLHQHGRETIGWEIVPVKTPEEALVTDQSGWIMIRTPNTDQCLGTPDGRNLLKMTCNSTAKKTLFSLIPSTTGAVQIKSVLSGLCFLDSKNSGLSFETGKCIADFKKPFEVVPQSHLWMLNPLNTESPII

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PYCRL Protein Vector (Mouse) (pPM-C-HA)
PV221372 500 ng

PYCRL Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Olfr397 (NM_146346) Mouse Untagged Clone
MC213527 10 µg

Olfr397 (NM_146346) Mouse Untagged Clone

Sign In for Pricing
View Details
Recombinant Rat Carbonic anhydrase 1 Protein, His, Yeast-1mg
QP5741-ye-1mg 1mg

Recombinant Rat Carbonic anhydrase 1 Protein, His, Yeast-1mg

Sign In for Pricing
View Details
SPRR4 Adenovirus (Mouse)
45397054 1.0 mL

SPRR4 Adenovirus (Mouse)

Sign In for Pricing
View Details
OFD1 Rabbit Polyclonal Antibody (FITC)
orb2607713 100 µg

OFD1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
WDR8 Double Nickase Plasmid (m2)
sc-425548-NIC-2 20 µg

WDR8 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details