Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phleum pratense Profilin-2 (PRO2)

This Recombinant Phleum pratense Profilin-2 (PRO2) spans the amino acid sequence from region 2-131aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen Phl p 11, Pollen allergen Phl p 12, Profilin 4, Phl p 12

UniProt

O24650

Expression Region

2-131aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Phleum pratense (Common timothy)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SWQTYVDEHLMCEIEGHHLASAAILGHDGTVWAQSADFPQFKPEEITGIMKDFDEPGHLAPTGMFVAGAKYMVIQGEPGAVIRGKKGAGGITIKKTGQALVVGIYDEPMTPGQCNMVVERLGDYLVEQGM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLDN2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV621271 1.0 µg DNA

CLDN2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Nori® Ferret MMP-25 ELISA Kit
GR201196 96 Well

Nori® Ferret MMP-25 ELISA Kit

Sign In for Pricing
View Details
Human GDF5/Growth/differentiation factor 5 ELISA Kit
E45K00643 96 Tests

Human GDF5/Growth/differentiation factor 5 ELISA Kit

Sign In for Pricing
View Details
SEZ6L (NM_001184774) Human Tagged Lenti ORF Clone
RC230620L3 10 µg

SEZ6L (NM_001184774) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TYMP AAV Vector (Human) (CMV)
48889102 1 µg

TYMP AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
IDH2 Antibody
orb75448 100 µL

IDH2 Antibody

Sign In for Pricing
View Details