Recombinant Human Programmed cell death 1 ligand 1 (CD274), partial
This Recombinant Human Programmed cell death 1 ligand 1 (CD274), partial spans the amino acid sequence from region 19-134aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
PD-L1, PDCD1 ligand 1, Programmed death ligand 1, hPD-L1, B7 homolog 1, B7-H1, CD274
UniProt
Q9NZQ7
Expression Region
19-134aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Immunology & Inflammation
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
20.8 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPY
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![RNF11 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G10]](https://cdn.genprice.uk/products/937/6868c40a994c49e6dc404d90/imageurl/ta811049am.webp)
TA811049AM 100 µL
RNF11 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G10]
Sign In for Pricing
View Details ![KIF25 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D3]](https://cdn.genprice.uk/products/937/68dd1b70061270361ea18007/imageurl/ta505424am.webp)
TA505424AM 100 µL
KIF25 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D3]
Sign In for Pricing
View Details 
LC421632 20 µg
SR140 (U2SURP) (NM_001080415) Human Over-expression Lysate
Sign In for Pricing
View Details