Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CREB-binding protein (CREBBP), partial

This Recombinant Human CREB-binding protein (CREBBP), partial spans the amino acid sequence from region 1081-1197aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Histone lysine acetyltransferase CREBBP, Protein-lysine acetyltransferase CREBBP

UniProt

Q92793

Expression Region

1081-1197aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLSTIKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRXN1 Protein Vector (Human) (pPB-C-His)
PV105086 500 ng

NRXN1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Caspase-8 subunit p10 Rabbit Polyclonal Antibody (BF350)
orb1589409 100 µL

Caspase-8 subunit p10 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
Anti-CORIN Antibody
CQA2488-01 30 µL

Anti-CORIN Antibody

Sign In for Pricing
View Details
Anti-CORIN Antibody
CQA2488-02 50 μL

Anti-CORIN Antibody

Sign In for Pricing
View Details
Anti-CORIN Antibody
CQA2488-03 100 µL

Anti-CORIN Antibody

Sign In for Pricing
View Details
Anti-CORIN Antibody
CQA2488-04 200 µL

Anti-CORIN Antibody

Sign In for Pricing
View Details