What is the catalog number for Recombinant Human Aminopeptidase N (ANPEP), partial?

The catalog number for Recombinant Human Aminopeptidase N (ANPEP), partial is orb1096196.

What sizes are available for Recombinant Human Aminopeptidase N (ANPEP), partial?

Recombinant Human Aminopeptidase N (ANPEP), partial is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Recombinant Human Aminopeptidase N (ANPEP), partial come in?

Recombinant Human Aminopeptidase N (ANPEP), partial is available in 3 different pack sizes.

Is Recombinant Human Aminopeptidase N (ANPEP), partial in stock?

Recombinant Human Aminopeptidase N (ANPEP), partial is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Human Aminopeptidase N (ANPEP), partial

This Recombinant Human Aminopeptidase N (ANPEP), partial spans the amino acid sequence from region 34-219aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AP-N, hAPN, Alanyl aminopeptidase, Aminopeptidase M, AP-M, Microsomal aminopeptidase, Myeloid plasma membrane glycoprotein CD13, gp150, CD13

UniProt

P15144

Expression Region

34-219aa

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SQEKNKNANSSPVASTTPSASATTNPASATTLDQSKAWNRYRLPNTLKPDSYRVTLRPYLTPNDRGLYVFKGSSTVRFTCKEATDVIIIHSKKLNYTLSQGHRVVLRGVGGSQPPDIDKTELVEPTEYLVVHLKGSLVKDSQYEMDSEFEGELADDLAGFYRSEYMEGNVRKVVATTQMQAADARK