Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serine protease inhibitor Kazal-type 1 (SPINK1), partial

This Recombinant Human Serine protease inhibitor Kazal-type 1 (SPINK1), partial spans the amino acid sequence from region 19-79aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pancreatic secretory trypsin inhibitor, Tumor-associated trypsin inhibitor, TATI

UniProt

P00995

Expression Region

19-79aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GNTGADSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Matrix Metalloproteinase-13
7-03166 1 µg

Recombinant Human Matrix Metalloproteinase-13

Sign In for Pricing
View Details
Anti-RAB7A Antibody Picoband® Fluoro488 Conjugated
A02409-2-Fluoro488 100 µg/Vial

Anti-RAB7A Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
ABCA13 Protein Vector (Mouse) (pPM-C-HA)
11012024 500 ng

ABCA13 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Compound T130990
orb3172680-01 1 mg

Compound T130990

Sign In for Pricing
View Details
Compound T130990
orb3172680-02 2 mg

Compound T130990

Sign In for Pricing
View Details
Compound T130990
orb3172680-03 3 mg

Compound T130990

Sign In for Pricing
View Details