Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Promotilin (MLN)

This Recombinant Human Promotilin (MLN) spans the amino acid sequence from region 26-115aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P12872

Expression Region

26-115aa

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FVPIFTYGELQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPLEIGMRMNSRQLEKYPATLEGLLSEMLPQHAAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aminoadipate aminotransferase (AADAT) (Center) Rabbit Polyclonal Antibody
AP50010PU-N 400 µL

Aminoadipate aminotransferase (AADAT) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cyclin B1 (CCNB1) (Center) Rabbit Polyclonal Antibody
AP50806PU-N 400 µL

Cyclin B1 (CCNB1) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant YWHAB Antibody
RC-4239-01 50 μL

Recombinant YWHAB Antibody

Sign In for Pricing
View Details
Recombinant YWHAB Antibody
RC-4239-02 100 µL

Recombinant YWHAB Antibody

Sign In for Pricing
View Details
Recombinant YWHAB Antibody
RC-4239-03 1 mL

Recombinant YWHAB Antibody

Sign In for Pricing
View Details
CD71 (66IG10), CF740 conjugate, 0.1mg/mL
BNC740871-100 1x 100 µL

CD71 (66IG10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details