Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Avian infectious bronchitis virus Non-structural protein 3b (3b)

This Recombinant Avian infectious bronchitis virus Non-structural protein 3b (3b) spans the amino acid sequence from region 1-63aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ns3b, Accessory protein 3b

UniProt

P30243

Expression Region

1-63aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Avian infectious bronchitis virus (strain UK/68/84) (IBV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

8.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLDFEAIIEAGEQLIQKISFDLQHISSVLNTQVFDPFEYCYYRGGSFWEIESAEEFSGDDEFT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CERS5 Knockout A549 Polyclonal Cells
ARG10521 1 Million

CERS5 Knockout A549 Polyclonal Cells

Sign In for Pricing
View Details
Rabbit anti-KANK2 Antibody
DL99124A-01 50 µL

Rabbit anti-KANK2 Antibody

Sign In for Pricing
View Details
Rabbit anti-KANK2 Antibody
DL99124A-02 100 µL

Rabbit anti-KANK2 Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal ZAG Antibody (153) [DyLight 594]
NBP2-90200DL594 0.1 mL

Rabbit Monoclonal ZAG Antibody (153) [DyLight 594]

Sign In for Pricing
View Details
Rat Wistar Plasma
IRTWIPLAK2E500ML 1 Each

Rat Wistar Plasma

Sign In for Pricing
View Details
Histone H2B (Acetyl-Lys12) Rabbit Polyclonal Antibody
orb251826 100 µL

Histone H2B (Acetyl-Lys12) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details