Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Avian infectious bronchitis virus Non-structural protein 3b (3b)

This Recombinant Avian infectious bronchitis virus Non-structural protein 3b (3b) spans the amino acid sequence from region 1-64aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ns3b, Accessory protein 3b

UniProt

P30241

Expression Region

1-64aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Avian infectious bronchitis virus (strain Beaudette) (IBV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

8.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLNLEVIIETGEQVIQKISFNLQHISSVLNTEVFDPFDYCYYRGGNFWEIESAEDCSGDDEFIE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTPNS1L2 Rabbit Polyclonal Antibody (AP)
orb965132 100 µL

PTPNS1L2 Rabbit Polyclonal Antibody (AP)

Sign In for Pricing
View Details
N-[[[(1S)-4-Amino-1-[3-[(1R)-1-amino-2-hydroxyethyl]-1,2,4-oxadiazol-5-yl]-4-oxobutyl]propylamine]carbonyl]-L-threonine
TRC-A790280-100MG 100 mg

N-[[[(1S)-4-Amino-1-[3-[(1R)-1-amino-2-hydroxyethyl]-1,2,4-oxadiazol-5-yl]-4-oxobutyl]propylamine]carbonyl]-L-threonine

Sign In for Pricing
View Details
MT-ATP8 peptide
orb218844-01 1 mg

MT-ATP8 peptide

Sign In for Pricing
View Details
MT-ATP8 peptide
orb218844-02 5 mg

MT-ATP8 peptide

Sign In for Pricing
View Details
ADM2 Protein Vector (Mouse) (pPB-N-His)
PV152727 500 ng

ADM2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Murashige and Skoog Modified Basal Medium (Powder) discontinued
299698-01 50 L

Murashige and Skoog Modified Basal Medium (Powder) discontinued

Sign In for Pricing
View Details