Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Glycoprotein hormones alpha chain (CGA)

This Recombinant Dog Glycoprotein hormones alpha chain (CGA) spans the amino acid sequence from region 25-120aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Anterior pituitary glycoprotein hormones common subunit alpha, Follicle-stimulating hormone alpha chain, FSH-alpha, Follitropin alpha chain, Luteinizing hormone alpha chain, LSH-alpha, Lutropin alpha chain, Thyroid-stimulating hormone alpha chain, TSH-alpha, Thyrotropin alpha chain

UniProt

Q9XSW8

Expression Region

25-120aa

Tag

C-terminal 10xHis-tagged

Source

Yeast

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FPDGEFTMQGCPECKLKENKYFSKLGAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNAKVENHTECHCSTCYYHKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NRF2 Rabbit pAb
A11159-01 20 µL

NRF2 Rabbit pAb

Sign In for Pricing
View Details
NRF2 Rabbit pAb
A11159-02 1000 μL

NRF2 Rabbit pAb

Sign In for Pricing
View Details
NRF2 Rabbit pAb
A11159-03 100 μL

NRF2 Rabbit pAb

Sign In for Pricing
View Details
NRF2 Rabbit pAb
A11159-04 500 μL

NRF2 Rabbit pAb

Sign In for Pricing
View Details
BAX (BCL-2 Associated X Protein) BioAssayTM ELISA Kit (Rat) discontinued
382044 96 Tests

BAX (BCL-2 Associated X Protein) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
Triphen diol
HY-14570-01 5 mg

Triphen diol

Sign In for Pricing
View Details