Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Leukocyte cell-derived chemotaxin-2 (Lect2)

This Recombinant Mouse Leukocyte cell-derived chemotaxin-2 (Lect2) spans the amino acid sequence from region 19-151aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LECT-2, Chondromodulin II, ChM-II

UniProt

O88803

Expression Region

19-151aa

Tag

C-terminal 6xHis-Myc-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPWANICASKSSNEIRTCDSYGCGQYSAQRTQRHHPGVDVLCSDGSVVYAPFTGKIVGQEKPYRNKNAINDGIRLSGRGFCVKIFYIKPIKYKGSIKKGEKLGTLLPLQKIYPGIQSHVHVENCDSSDPTAYL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCTD13, CT (KCTD13, BACURD1, PDIP1, POLDIP1, BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 1, BTB/POZ domain-containing protein KCTD13, Polymerase delta-interacting protein 1, TNFAIP1-like protein) (APC) discontinued
037357-APC 200 µL

KCTD13, CT (KCTD13, BACURD1, PDIP1, POLDIP1, BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 1, BTB/POZ domain-containing protein KCTD13, Polymerase delta-interacting protein 1, TNFAIP1-like protein) (APC) discontinued

Sign In for Pricing
View Details
Pla2g2c sgRNA CRISPR Lentivector set (Mouse)
K3304101 3x 1.0 µg

Pla2g2c sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
PROKR2 Antibody, FITC conjugated
A32087-50UG 50 µg

PROKR2 Antibody, FITC conjugated

Sign In for Pricing
View Details
PathScan® Total Zap-70 Sandwich ELISA Kit
CST 7172V1 5 Kit

PathScan® Total Zap-70 Sandwich ELISA Kit

Sign In for Pricing
View Details
Mouse glucocorticoid receptor, Nr3c1 ELISA KIT
E0659Mo-01 48 Well

Mouse glucocorticoid receptor, Nr3c1 ELISA KIT

Sign In for Pricing
View Details
Mouse glucocorticoid receptor, Nr3c1 ELISA KIT
E0659Mo-02 96 Well

Mouse glucocorticoid receptor, Nr3c1 ELISA KIT

Sign In for Pricing
View Details