Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Glycoprotein hormone beta-5 (Gphb5)

This Recombinant Mouse Glycoprotein hormone beta-5 (Gphb5) spans the amino acid sequence from region 25-130aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thyrostimulin subunit beta

UniProt

Q812B2

Expression Region

25-130aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SSSGNLHTFVGCAVREFTFMAKKPGCRGLRITTDACWGRCETWEKPILEPPYIEAYHRVCTYNETRQVTVKLPNCAPGVDPFYTYPMAVRCDCGACSTATTECETI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Braf (NM_139294) Mouse Tagged Lenti ORF Clone
MR223023L3 10 µg

Braf (NM_139294) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
PCYOX1 (NM_016297) Human Tagged ORF Clone
RG208722 10 µg

PCYOX1 (NM_016297) Human Tagged ORF Clone

Sign In for Pricing
View Details
Desmethyl-VS-5584 1mg
A10900-1 1 mg

Desmethyl-VS-5584 1mg

Sign In for Pricing
View Details
Human DPPII/QPP/DPP7 DuoSet ELISA 5 Plate
DY3438-05 5 Plates

Human DPPII/QPP/DPP7 DuoSet ELISA 5 Plate

Sign In for Pricing
View Details
4-Azaindole 98+% (HPLC)
232851-01 1 g

4-Azaindole 98+% (HPLC)

Sign In for Pricing
View Details
4-Azaindole 98+% (HPLC)
232851-02 5 g

4-Azaindole 98+% (HPLC)

Sign In for Pricing
View Details