Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Avian infectious bronchitis virus Replicase polyprotein 1ab (rep), partial

This Recombinant Avian infectious bronchitis virus Replicase polyprotein 1ab (rep), partial spans the amino acid sequence from region 1-219aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pp1ab, ORF1ab polyprotein

UniProt

P12723

Expression Region

1-219aa

Tag

C-terminal 6xHis-tagged

Source

Baculovirus

Origin

Avian infectious bronchitis virus (strain KB8523) (IBV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GGGGQSFLAADNAVLVSTQCYKRHSYVEIPSNLLVQNGMSLKDGANLYVYKRVNGAFVTLPNTLNTQGRSYETFEPRSDVERDFLDMSEEDFVEKYGKDLGLQHILYGEVDKPQLGGLHTVIGMYRLLRANKLNAKSVTNSDSDVMQNYFVLADNGSYKQVCTVVDLLLDDFLELLRNILNEYGTNKSKVVTVSIDYHSINFMTWFEDGSIKTCYPQLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB14 Goat Polyclonal Antibody
AB0014-200 400 µg

RAB14 Goat Polyclonal Antibody

Sign In for Pricing
View Details
ExoBriteTM 490/515 CD9 Flow Antibody (25 tests)
P003-490-125 1x 125 µL

ExoBriteTM 490/515 CD9 Flow Antibody (25 tests)

Sign In for Pricing
View Details
GABRG3 Human qPCR Primer Pair (NM_033223)
HP216369 200 Reactions

GABRG3 Human qPCR Primer Pair (NM_033223)

Sign In for Pricing
View Details
Galacto-PUGNAc
TRC-G153200-5MG 5 mg

Galacto-PUGNAc

Sign In for Pricing
View Details
Human Lambda Light Chain (HP6054), 1mg/mL
BNUM0262-50 1x 50 µL

Human Lambda Light Chain (HP6054), 1mg/mL

Sign In for Pricing
View Details
Human CIDE B (CIDEB) activation kit by CRISPRa
GA109032 1 Kit

Human CIDE B (CIDEB) activation kit by CRISPRa

Sign In for Pricing
View Details