Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Disco-interacting protein 2 homolog A (DIP2A), partial

This Recombinant Human Disco-interacting protein 2 homolog A (DIP2A), partial spans the amino acid sequence from region 9-127aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DIP2 homolog A

UniProt

Q14689

Expression Region

9-127aa

Tag

C-terminal 6xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EAAPLPAEVRESLAELELELSEGDITQKGYEKKRAKLLARYIPLIQGIDPSLQAENRIPGPSQTTAAAPKQQKSRPTASRDERFRSDVHTEAVQAALAKYKERKMPMPSKRRSVLVHSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(±)-Doxylamine
TRC-D562005-500MG 500 mg

(±)-Doxylamine

Sign In for Pricing
View Details
Polystyrene A PHB
HA40045013.5G 5 g

Polystyrene A PHB

Sign In for Pricing
View Details
Tyrosinase (Melanoma Marker) (rOCA1/812), CF488A conjugate, 0.1mg/mL
BNC882215-100 1x 100 µL

Tyrosinase (Melanoma Marker) (rOCA1/812), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Mouse ADAM15 Protein (His Tag)
PKSM040394 100 µg

Recombinant Mouse ADAM15 Protein (His Tag)

Sign In for Pricing
View Details
POLD1 Human Gene Knockout Kit (CRISPR)
KN201238RB 1 Kit

POLD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Horse IgM mu chain Antibody Peroxidase Conjugated
TA397203 20 mg

Horse IgM mu chain Antibody Peroxidase Conjugated

Sign In for Pricing
View Details