Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Disco-interacting protein 2 homolog C (DIP2C), partial

This Recombinant Human Disco-interacting protein 2 homolog C (DIP2C), partial spans the amino acid sequence from region 1-125aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DIP2 homolog C

UniProt

Q9Y2E4

Expression Region

1-125aa

Tag

C-terminal 6xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MADRSLEGMALPLEVRARLAELELELSEGDITQKGYEKKRSKLIGAYLPQPPRVDQALPQERRAPVTPSSASRYHRRRSSGSRDERYRSDVHTEAVQAALAKHKERKMAVPMPSKRRSLVVQTSM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P15RS (A-3) : m-IgG Fc BP-HRP Bundle
sc-538805 1 Kit

P15RS (A-3) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
Anti-C-C chemokine receptor type 9 CCR9 Antibody
A02348 100 µL

Anti-C-C chemokine receptor type 9 CCR9 Antibody

Sign In for Pricing
View Details
HIV TAT specific factor 1 (HTATSF1) (NM_014500) Human Untagged Clone
SC114990 10 µg

HIV TAT specific factor 1 (HTATSF1) (NM_014500) Human Untagged Clone

Sign In for Pricing
View Details
Mouse Adam24 ELISA KIT
ELI-11807m 96 Tests

Mouse Adam24 ELISA KIT

Sign In for Pricing
View Details
Human STARD7 siRNA
abx935400-01 15 nmol

Human STARD7 siRNA

Sign In for Pricing
View Details
Human STARD7 siRNA
abx935400-02 30 nmol

Human STARD7 siRNA

Sign In for Pricing
View Details