Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Avian infectious bronchitis virus Replicase polyprotein 1ab (rep), partial

This Recombinant Avian infectious bronchitis virus Replicase polyprotein 1ab (rep), partial spans the amino acid sequence from region 1-219aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pp1ab, ORF1ab polyprotein

UniProt

P12723

Expression Region

1-219aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Avian infectious bronchitis virus (strain KB8523) (IBV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GGGGQSFLAADNAVLVSTQCYKRHSYVEIPSNLLVQNGMSLKDGANLYVYKRVNGAFVTLPNTLNTQGRSYETFEPRSDVERDFLDMSEEDFVEKYGKDLGLQHILYGEVDKPQLGGLHTVIGMYRLLRANKLNAKSVTNSDSDVMQNYFVLADNGSYKQVCTVVDLLLDDFLELLRNILNEYGTNKSKVVTVSIDYHSINFMTWFEDGSIKTCYPQLQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCR V β 4 (KT4) PE
sc-53476 PE 200 µg/mL

TCR V β 4 (KT4) PE

Sign In for Pricing
View Details
Domoic Acid Antibody
abx022967 20 µL

Domoic Acid Antibody

Sign In for Pricing
View Details
Itgam sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6822405 3x 1.0 µg

Itgam sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
SCAMP3 Rabbit Polyclonal Antibody (Fluoro647)
orb3099118 100 µg

SCAMP3 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Human Neuropeptide S (NPS) ELISA Kit
DLR-NPS-Hu-96T 96 Tests

Human Neuropeptide S (NPS) ELISA Kit

Sign In for Pricing
View Details
Human Troponin T, fast skeletal muscle ELISA Kit
MBS289632-01 48 Well

Human Troponin T, fast skeletal muscle ELISA Kit

Sign In for Pricing
View Details