Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Avian infectious bronchitis virus Nucleoprotein (N)

This Recombinant Avian infectious bronchitis virus Nucleoprotein (N) spans the amino acid sequence from region 1-409aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nucleocapsid protein, NC, Protein N

UniProt

P69597

Expression Region

1-409aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Avian infectious bronchitis virus (strain Beaudette CK) (IBV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MASGKAAGKTDAPAPVIKLGGPKPPKVGSSGNASWFQAIKAKKLNTPPPKFEGSGVPDNENIKPSQQHGYWRRQARFKPGKGGRKPVPDAWYFYYTGTGPAADLNWGDTQDGIVWVAAKGADTKSRSNQGTRDPDKFDQYPLRFSDGGPDGNFRWDFIPLNRGRSGRSTAASSAAASRAPSREGSRGRRSDSGDDLIARAAKIIQDQQKKGSRITKAKADEMAHRRYCKRTIPPNYRVDQVFGPRTKGKEGNFGDDKMNEEGIKDGRVTAMLNLVPSSHACLFGSRVTPKLQLDGLHLRFEFTTVVPCDDPQFDNYVKICDQCVDGVGTRPKDDEPKPKSRSSSRPATRGNSPAPRQQRPKKEKKLKKQDDEADKALTSDEERNNAQLEFYDEPKVINWGDAALGENEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GDF10 Antibody, HRP conjugated
A22957-50UG 50 µg

GDF10 Antibody, HRP conjugated

Sign In for Pricing
View Details
ACTN1 Peptide - N-terminal region (AAP58413)
AAP58413-100UG 100 µg

ACTN1 Peptide - N-terminal region (AAP58413)

Sign In for Pricing
View Details
RICS Recombinant Protein Antigen
NBP1-92334PEP 0.1 mL

RICS Recombinant Protein Antigen

Sign In for Pricing
View Details
Fbxl12 sgRNA CRISPR Lentivector set (Rat)
K7132201 3x 1.0 µg

Fbxl12 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
anti-Glucose 6 phosphate isomerase
YF-PA12099 100 ug

anti-Glucose 6 phosphate isomerase

Sign In for Pricing
View Details
Dohh sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4945903 1.0 µg DNA

Dohh sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details