Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Avian infectious bronchitis virus Nucleoprotein (N)

This Recombinant Avian infectious bronchitis virus Nucleoprotein (N) spans the amino acid sequence from region 1-409aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nucleocapsid protein, NC, Protein N

UniProt

Q96598

Expression Region

1-409aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Avian infectious bronchitis virus (strain Vic S) (IBV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MASGKAAGKSDAPTPIIKLGGPKPPKIGSSGNASWFQAIKAKKLNVPQPKFEGSGVPDNNNIKPSQQHGYWRRQARYKPGKSGRKPVPDAWYFYYTGTGPAADLNWGENQDGIVWVAAKGADTKSRSNQGTRDPDKFDQYPLRFSDGGPDGNFRWDFIPLNRGRSGRSTAASSAASSRAPSREGSRGRRSGAEDDLIARAAKIIQDQQKRGSRITKAKADEMAHRRYCKRTIPPGYRVDQVFGPRTKGKEGNFGDDKMNEEGIKDGRVTATLNLIPSSHACLFGSRVTPKLQPDGLHLKFEFTTVVPRDDPQFDNYVKICDQCVDGVGTRPKDDEPRPKSRSSSRPATRGNSPAPRQQRPKKEKKPKKQDDEVDKALTSDEERNNAQLEFDDEPKVINWGDSALGENEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PECMV-Vegfa-m-FLAG
BZ16576 1 Vial

PECMV-Vegfa-m-FLAG

Sign In for Pricing
View Details
FAM55A Polyclonal Antibody, Biotin Conjugated
bs-16003R-Biotin 100 µL

FAM55A Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
D6Mm5e sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4332303 1.0 µg DNA

D6Mm5e sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Rabbit Monoclonal MUC1 Antibody (2336A) [DyLight 594]
FAB62981M 0.1 mL

Rabbit Monoclonal MUC1 Antibody (2336A) [DyLight 594]

Sign In for Pricing
View Details
FGGY (FLJ10986, FGGY Carbohydrate Kinase Domain-containing Protein)
126796 50 µg

FGGY (FLJ10986, FGGY Carbohydrate Kinase Domain-containing Protein)

Sign In for Pricing
View Details
Rabbit anti-Septin 7 Antibody, Affinity Purified
A304-213A 100 µg

Rabbit anti-Septin 7 Antibody, Affinity Purified

Sign In for Pricing
View Details