Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Disco-interacting protein 2 homolog A (DIP2A), partial

This Recombinant Human Disco-interacting protein 2 homolog A (DIP2A), partial spans the amino acid sequence from region 9-127aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DIP2 homolog A

UniProt

Q14689

Expression Region

9-127aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EAAPLPAEVRESLAELELELSEGDITQKGYEKKRAKLLARYIPLIQGIDPSLQAENRIPGPSQTTAAAPKQQKSRPTASRDERFRSDVHTEAVQAALAKYKERKMPMPSKRRSVLVHSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL3RB (CSF2RB) (NM_000395) Human Over-expression Lysate
LY424744 100 µg

IL3RB (CSF2RB) (NM_000395) Human Over-expression Lysate

Sign In for Pricing
View Details
C1orf69 (IBA57) Rabbit Polyclonal Antibody
TA361838 100 µL

C1orf69 (IBA57) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Pan PRDX Antibody
KC-30670-01 50 μL

Pan PRDX Antibody

Sign In for Pricing
View Details
Pan PRDX Antibody
KC-30670-02 100 µL

Pan PRDX Antibody

Sign In for Pricing
View Details
Pan PRDX Antibody
KC-30670-03 1 mL

Pan PRDX Antibody

Sign In for Pricing
View Details
M6PR (cation dependent) Recombinant Rabbit monoclonal Antibody
HA750681 100 µL

M6PR (cation dependent) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details