Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Avian infectious bronchitis virus Nucleoprotein (N)

This Recombinant Avian infectious bronchitis virus Nucleoprotein (N) spans the amino acid sequence from region 1-409aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nucleocapsid protein, NC, Protein N

UniProt

Q82616

Expression Region

1-409aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Avian infectious bronchitis virus (strain M41) (IBV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MASGKATGKTDAPAPVIKLGGPKPPKVGSSGNASWFQAIKANKLNIPPPKFEGSGVPDNENLKSSQQHGYWRRQATFKPGKGGRKPVPDAWYFYYTGTGPAANLNWGDSQDGIVWVAGKGADTKFRSNQGTRDSDKFDQYPLRFSDGGPDGNFRWDFIPLNGGRSGRSTAASSAASSRAPSREVSRGRRSGSEDDLIARAARIIQDQQKKGSRITKAKADEMAHRRYCKRTIPPNYKVDQVFGPRTKGKEGNFGDDKMNEEGIKDGRVTAMLNLVPSSHACLFGSRVTPKLQPDGLHLKFEFTTVVPRDDPQFDNYVKICDQCVDGVGTRPKDDEPRPKSRSSSRPATRGNSPAPRQQRPKKEKKPKKHDDEVDKALTSDEERNNAQLEFYDEPKVINWGDAALGENEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGC1 alpha (PPARGC1A) Human Gene Knockout Kit (CRISPR)
KN212244RB 1 Kit

PGC1 alpha (PPARGC1A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Med31 (NM_026068) Mouse Tagged ORF Clone
MG200743 10 µg

Med31 (NM_026068) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Bahcc1 Mouse Gene Knockout Kit (CRISPR)
KN501961 1 Kit

Bahcc1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
H4-16 Rabbit Monoclonal Antibody
TA422377 100 µL

H4-16 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
(+)-Isolysergic Acid Diethylamide
TRC-I821060-1MG 1 mg

(+)-Isolysergic Acid Diethylamide

Sign In for Pricing
View Details
Mix-n-StainTM CF®660C Antibody Labeling Kit, 1x (20-50ug) labeling
#92260 1 Kit

Mix-n-StainTM CF®660C Antibody Labeling Kit, 1x (20-50ug) labeling

Sign In for Pricing
View Details