Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 5-hydroxytryptamine receptor 1D (HTR1D), partial

This Recombinant Human 5-hydroxytryptamine receptor 1D (HTR1D), partial spans the amino acid sequence from region 1-38aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

5-HT-1D, 5-HT1D, Serotonin 1D alpha receptor, 5-HT-1D-alpha, Serotonin receptor 1D

UniProt

P28221

Expression Region

1-38aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XRCC3 (DNA Repair Protein XRCC3, X-ray Repair Cross-complementing Protein 3) discontinued
361461-01 50 µL

XRCC3 (DNA Repair Protein XRCC3, X-ray Repair Cross-complementing Protein 3) discontinued

Sign In for Pricing
View Details
XRCC3 (DNA Repair Protein XRCC3, X-ray Repair Cross-complementing Protein 3) discontinued
361461-02 100 µL

XRCC3 (DNA Repair Protein XRCC3, X-ray Repair Cross-complementing Protein 3) discontinued

Sign In for Pricing
View Details
Hamster Copine I (CPNE1) ELISA Kit
MBS9906511-01 48 Well

Hamster Copine I (CPNE1) ELISA Kit

Sign In for Pricing
View Details
Hamster Copine I (CPNE1) ELISA Kit
MBS9906511-02 96 Well

Hamster Copine I (CPNE1) ELISA Kit

Sign In for Pricing
View Details
Hamster Copine I (CPNE1) ELISA Kit
MBS9906511-03 5x 96 Well

Hamster Copine I (CPNE1) ELISA Kit

Sign In for Pricing
View Details
Hamster Copine I (CPNE1) ELISA Kit
MBS9906511-04 10x 96 Well

Hamster Copine I (CPNE1) ELISA Kit

Sign In for Pricing
View Details