Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Tumor necrosis factor ligand superfamily member 4 (TNFSF4), partial

This Recombinant Rabbit Tumor necrosis factor ligand superfamily member 4 (TNFSF4), partial spans the amino acid sequence from region 45-187aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

OX40 ligand, OX40L, CD252

UniProt

O02765

Expression Region

45-187aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Cancer Biology; Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QHSHAPEVSLQYPPIENIMTQLQILTSHECEEDSFILPLQKRDGTMEVQNNSVVIQCDGFYLLSLKGYFSQEVSISLHYRKGEEPFPILKKTKFANSNVVLKLGYKDKVYLNVTTDSASCKQLSVNAGELIVILQNPGGYCAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PREPL Recombinant Rabbit Monoclonal Antibody [JE65-64]
HA721069 100 µL

PREPL Recombinant Rabbit Monoclonal Antibody [JE65-64]

Sign In for Pricing
View Details
Recombinant PKR Antibody
RC-4438-01 50 μL

Recombinant PKR Antibody

Sign In for Pricing
View Details
Recombinant PKR Antibody
RC-4438-02 100 µL

Recombinant PKR Antibody

Sign In for Pricing
View Details
Recombinant PKR Antibody
RC-4438-03 1 mL

Recombinant PKR Antibody

Sign In for Pricing
View Details
MYBPC3 (NM_000256) Human Over-expression Lysate
LC424835 20 µg

MYBPC3 (NM_000256) Human Over-expression Lysate

Sign In for Pricing
View Details
CDC14B (NM_001077181) Human Over-expression Lysate
LY421370 100 µg

CDC14B (NM_001077181) Human Over-expression Lysate

Sign In for Pricing
View Details