Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human C-C chemokine receptor type 8 (CCR8), partial

This Recombinant Human C-C chemokine receptor type 8 (CCR8), partial spans the amino acid sequence from region 74-129aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CC chemokine receptor CHEMR1, CMKBRL2Chemokine receptor-like 1, CKR-L1, GPR-CY6, GPRCY6, TER1, CDw198

UniProt

P51685

Expression Region

74-129aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

9.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LLNLALSDLLFVFSFPFQTYYLLDQWVFGTVMCKVVSGFYYIGFYSSMFFITLMSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Naphthol Yellow S
GT6579-25g 25 g

Naphthol Yellow S

Sign In for Pricing
View Details
cdc45 antibody
MBS9403487-01 0.05 mL

cdc45 antibody

Sign In for Pricing
View Details
cdc45 antibody
MBS9403487-02 0.1 mL

cdc45 antibody

Sign In for Pricing
View Details
cdc45 antibody
MBS9403487-03 5x 0.1 mL

cdc45 antibody

Sign In for Pricing
View Details
Human C9 Knockout A549 cell line
GTR15419539 1 Vial

Human C9 Knockout A549 cell line

Sign In for Pricing
View Details
TAGAP cDNA Clone
MBS1269833-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

TAGAP cDNA Clone

Sign In for Pricing
View Details