Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Avian infectious bronchitis virus Nucleoprotein (N)

This Recombinant Avian infectious bronchitis virus Nucleoprotein (N) spans the amino acid sequence from region 1-409aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nucleocapsid protein, NC, Protein N

UniProt

P12648

Expression Region

1-409aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Avian infectious bronchitis virus (strain KB8523) (IBV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MASGKATGKTDAPAPVIKLGGPKPPKVGSSGNASWFQAIKAKKLNSPPLKFEGSGVPDNENLKTSQQHGYWRRQARFKPSKGGRKPVPDAWYFYYTGTGPAADLNWGDSQDGIVWVAAKGADTKSRSNQGTRDPDKFDQYPLRFSDGGPDGNFRWDFIPLNRGRSGKSTAASSAASSRAPSREGSRGRRSGAEDDLIARAAKIIQDQQKKGARITKAKADEMAHRRYCKRTIPPGYKVDQVFGPRTKGKEGNFGDDKMNEEGIKDGRVTAMLNLVPSSHACLFGSRVTPKLQPDGLHLKFEFTTVVSRNDPQFDNYVKICDQCVDGVGTRPKDDEPKPKSRSSSRPATRTSSPAPRQPRPKKEKKTKKQDDEVDKALTSDEERNNAQLEFDDEPKVINWGDSALGENEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZytoLight® FOXO1/PAX3 Dual Color Single Fusion Probe
ZTV-Z-2018-200 200 µL

ZytoLight® FOXO1/PAX3 Dual Color Single Fusion Probe

Sign In for Pricing
View Details
ZSWIM8 Lentiviral Activation Particles (m2)
sc-435271-LAC-2 200 µL

ZSWIM8 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Ac-YVAD-CHO acetate
T73852-01 5 mg

Ac-YVAD-CHO acetate

Sign In for Pricing
View Details
Ac-YVAD-CHO acetate
T73852-02 50 mg

Ac-YVAD-CHO acetate

Sign In for Pricing
View Details
Mouse Monoclonal ACADS Antibody (OTI1D2) [Alexa Fluor 647]
NBP2-70061AF647 0.1 mL

Mouse Monoclonal ACADS Antibody (OTI1D2) [Alexa Fluor 647]

Sign In for Pricing
View Details
Rabbit Polyclonal Influenza B Hemagglutinin Antibody
NBP3-06576-100ul 100 µL

Rabbit Polyclonal Influenza B Hemagglutinin Antibody

Sign In for Pricing
View Details