Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Phleum pratense Pollen allergen Phl p 6 (PHLPVI)

This Recombinant Phleum pratense Pollen allergen Phl p 6 (PHLPVI) spans the amino acid sequence from region 23-132aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Allergen Phl p VI, Phl p 6

UniProt

P43215

Expression Region

23-132aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Phleum pratense (Common timothy)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GKATTEEQKLIEDVNASFRAAMATTANVPPADKYKTFEAAFTVSSKRNLADAVSKAPQLVPKLDEVYNAAYNAADHAAPEDKYEAFVLHFSEALRIIAGTPEVHAVKPGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP20 Rabbit Polyclonal Antibody (Biotin)
orb458548 100 µL

MMP20 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
16-Dehydroprogesterone 5mg
A18550-5 5 mg

16-Dehydroprogesterone 5mg

Sign In for Pricing
View Details
Septin 3 (SEPT3) (NM_019106) Human Recombinant Protein
TP315714 20 µg

Septin 3 (SEPT3) (NM_019106) Human Recombinant Protein

Sign In for Pricing
View Details
Human HGF Antibody
E55A12306 100 µg

Human HGF Antibody

Sign In for Pricing
View Details
ZFYVE21 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
51230064 1.0 µg DNA

ZFYVE21 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
MMAB Antibody
MBS8576144-01 0.2 mL

MMAB Antibody

Sign In for Pricing
View Details