Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Lysozyme C (LYZ) (E53A)

This Recombinant Chicken Lysozyme C (LYZ) (E53A) spans the amino acid sequence from region 19-147aa (E53A) . Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

1,4-beta-N-acetylmuramidase C, Allergen Gal d IV, Gal d 4

UniProt

P00698

Expression Region

19-147aa (E53A)

Tag

Tag-Free

Source

E.coli

Origin

Gallus gallus (Chicken)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFASNFNTQATNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDGNGMNAWVAWRNRCKGTDVQAWIRGCRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COL27A1 ORF Vector (Human) (pORF)
16572011 1.0 µg DNA

COL27A1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
ETS-related gene Antibody / Transcriptional regulator ERG
V4841-100UG 100 µg

ETS-related gene Antibody / Transcriptional regulator ERG

Sign In for Pricing
View Details
1- (2,3-Dihydro-benzo[1,4]dioxine-6-sulfonyl) -4-hydroxy-pyrrolidine-2-carboxylic acid
sc-332385 1 g

1- (2,3-Dihydro-benzo[1,4]dioxine-6-sulfonyl) -4-hydroxy-pyrrolidine-2-carboxylic acid

Sign In for Pricing
View Details
Recombinant Laribacter hongkongensis Urease subunit gamma (ureA)
MBS1242828-01 0.02 mg (E-Coli)

Recombinant Laribacter hongkongensis Urease subunit gamma (ureA)

Sign In for Pricing
View Details
Recombinant Laribacter hongkongensis Urease subunit gamma (ureA)
MBS1242828-02 0.1 mg (E-Coli)

Recombinant Laribacter hongkongensis Urease subunit gamma (ureA)

Sign In for Pricing
View Details
Recombinant Laribacter hongkongensis Urease subunit gamma (ureA)
MBS1242828-03 0.02 mg (Yeast)

Recombinant Laribacter hongkongensis Urease subunit gamma (ureA)

Sign In for Pricing
View Details