Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arabidopsis thaliana Plasmodesmata-located protein 7 (PDLP7)

This Recombinant Arabidopsis thaliana Plasmodesmata-located protein 7 (PDLP7) spans the amino acid sequence from region 31-298aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cysteine-rich repeat secretory protein 60

UniProt

Q0WPN8

Expression Region

31-298aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Epigenetics, Infectious Diseases

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TSATDTFVFGGCSQQKFSPASAYESNLNSLLTSLVNSATYSSYNNFTIMGSSSSDTARGLFQCRGDLSMPDCATCVARAVSQVGPLCPFTCGGALQLAGCYIKYDNISFLGQEDKTVVLKKCGSSEGYNTDGISRRDAVLTELVNGGGYFRAGGSGDVQGMGQCVGDLTVSECQDCLGTAIGRLKNDCGTAVFGDMFLAKCYARYSTDGAQHYAKSHNYKTNYGGEKTFAIIIGLLAAVVLLIIFLLFLRGVCSRGGDFSILHSFTLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bradykinin [Hyp3]
B2675-24 1 mg

Bradykinin [Hyp3]

Sign In for Pricing
View Details
2-Amino-1-[4- (2-hydroxy-ethyl) -piperazin-1-yl]-ethanone dihydrochloride
sc-321469 1 g

2-Amino-1-[4- (2-hydroxy-ethyl) -piperazin-1-yl]-ethanone dihydrochloride

Sign In for Pricing
View Details
TRNAC29 Protein Vector (Human) (pPM-C-HA)
PV138448 500 ng

TRNAC29 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Rabbit Anti IGF2BP3 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot,IHC)
IRBAMLIGF2BP3AP355200UL 1 Each

Rabbit Anti IGF2BP3 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot,IHC)

Sign In for Pricing
View Details
EPHA4 AAV siRNA Pooled Vector
19357161 1.0 µg

EPHA4 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Rabbit Polyclonal HOXC4 Antibody
NBP3-04943-20ul 20 µL

Rabbit Polyclonal HOXC4 Antibody

Sign In for Pricing
View Details