Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Glutaminyl-peptide cyclotransferase (QPCT)

This Recombinant Human Glutaminyl-peptide cyclotransferase (QPCT) spans the amino acid sequence from region 29-361aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glutaminyl cyclase , QC , sQCGlutaminyl-tRNA cyclotransferaseGlutamyl cyclase , EC

UniProt

Q16769

Expression Region

29-361aa

Tag

N-terminal 10xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPBP1 (NM_001127235) Human Tagged ORF Clone Lentiviral Particle
RC225848L3V 200 µL

GPBP1 (NM_001127235) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Glutamate Receptor, Ionotropic, AMPA 3 (GRIA3), Recombinant, Mouse, His-Tag
055732-01 10 µg

Glutamate Receptor, Ionotropic, AMPA 3 (GRIA3), Recombinant, Mouse, His-Tag

Sign In for Pricing
View Details
Glutamate Receptor, Ionotropic, AMPA 3 (GRIA3), Recombinant, Mouse, His-Tag
055732-02 50 µg

Glutamate Receptor, Ionotropic, AMPA 3 (GRIA3), Recombinant, Mouse, His-Tag

Sign In for Pricing
View Details
Glutamate Receptor, Ionotropic, AMPA 3 (GRIA3), Recombinant, Mouse, His-Tag
055732-03 100 µg

Glutamate Receptor, Ionotropic, AMPA 3 (GRIA3), Recombinant, Mouse, His-Tag

Sign In for Pricing
View Details
Glutamate Receptor, Ionotropic, AMPA 3 (GRIA3), Recombinant, Mouse, His-Tag
055732-04 200 µg

Glutamate Receptor, Ionotropic, AMPA 3 (GRIA3), Recombinant, Mouse, His-Tag

Sign In for Pricing
View Details
2,2-Difluoro-3-hydroxy-4-methyl-pentanoic acid
419285-01 500 mg

2,2-Difluoro-3-hydroxy-4-methyl-pentanoic acid

Sign In for Pricing
View Details