Recombinant Rabbit Tumor necrosis factor ligand superfamily member 4 (TNFSF4), partial
This Recombinant Rabbit Tumor necrosis factor ligand superfamily member 4 (TNFSF4), partial spans the amino acid sequence from region 45-187aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
OX40 ligand, OX40L, CD252
UniProt
O02765
Expression Region
45-187aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
Baculovirus
Origin
Oryctolagus cuniculus (Rabbit)
Field of Research
Cancer Biology; Immunology & Inflammation
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
19.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
QHSHAPEVSLQYPPIENIMTQLQILTSHECEEDSFILPLQKRDGTMEVQNNSVVIQCDGFYLLSLKGYFSQEVSISLHYRKGEEPFPILKKTKFANSNVVLKLGYKDKVYLNVTTDSASCKQLSVNAGELIVILQNPGGYCAP
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![ZNF264 Mouse Monoclonal Antibody [Clone ID: OTI6F3]](https://cdn.genprice.uk/products/937/68dd18ba061270361e908871/imageurl/cf810472.webp)
CF810472 100 µg
ZNF264 Mouse Monoclonal Antibody [Clone ID: OTI6F3]
Sign In for Pricing
View Details 
BNC402160-100 1x 100 µL
CD86 (Dendritic Cells Maturation Marker) (C86/2160R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 