Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human P-selectin (SELP), partial

This Recombinant Human P-selectin (SELP), partial spans the amino acid sequence from region 42-771aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD62 antigen-like family member P, Granule membrane protein 140, GMP-140, Leukocyte-endothelial cell adhesion molecule 3, LECAM3, Platelet activation dependent granule-external membrane protein, PADGEM, CD62P

UniProt

P16109

Expression Region

42-771aa

Tag

C-terminal hFc1-Myc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

108.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

WTYHYSTKAYSWNISRKYCQNRYTDLVAIQNKNEIDYLNKVLPYYSSYYWIGIRKNNKTWTWVGTKKALTNEAENWADNEPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGNYTCSCYPGFYGPECEYVRECGELELPQHVLMNCSHPLGNFSFNSQCSFHCTDGYQVNGPSKLECLASGIWTNKPPQCLAAQCPPLKIPERGNMTCLHSAKAFQHQSSCSFSCEEGFALVGPEVVQCTASGVWTAPAPVCKAVQCQHLEAPSEGTMDCVHPLTAFAYGSSCKFECQPGYRVRGLDMLRCIDSGHWSAPLPTCEAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGFMLRGADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEARVNCSHPFGAFRYQSVCSFTCNEGLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMTCVQPLGSSSYKSTCQFICDEGYSLSGPERLDCTRSGRWTDSPPMCEAIKCPELFAPEQGSLDCSDTRGEFNVGSTCHFSCDNGFKLEGPNNVECTTSGRWSATPPTCKGIASLPTPGLQCPALTTPGQGTMYCRHHPGTFGFNTTCYFGCNAGFTLIGDSTLSCRPSGQWTAVTPACRAVKCSELHVNKPIAMNCSNLWGNFSYGSICSFHCLEGQLLNGSAQTACQENGHWSTTVPTCQAGPLTIQEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SYT (D-3) Alexa Fluor® 680
sc-390615 AF680 200 µg/mL

SYT (D-3) Alexa Fluor® 680

Sign In for Pricing
View Details
Keratin 18 discontinued
376504 500 µg

Keratin 18 discontinued

Sign In for Pricing
View Details
Recombinant Human FAM46A Protein - (Dry Ice)
H00055603-P01-10ug 10 µg

Recombinant Human FAM46A Protein - (Dry Ice)

Sign In for Pricing
View Details
Carbofuran-13C6
443935 1 mg

Carbofuran-13C6

Sign In for Pricing
View Details
Mouse CD40 Ligand/TNFSF5 (NP_035746) VersaClone cDNA
RDC1395 10 µg

Mouse CD40 Ligand/TNFSF5 (NP_035746) VersaClone cDNA

Sign In for Pricing
View Details
Ifit1bl1 Mouse shRNA Lentiviral Particle (Locus ID 667373)
TL518485V 500 µL Each

Ifit1bl1 Mouse shRNA Lentiviral Particle (Locus ID 667373)

Sign In for Pricing
View Details