Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human P-selectin (SELP), partial

This Recombinant Human P-selectin (SELP), partial spans the amino acid sequence from region 42-771aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD62 antigen-like family member P, Granule membrane protein 140, GMP-140, Leukocyte-endothelial cell adhesion molecule 3, LECAM3, Platelet activation dependent granule-external membrane protein, PADGEM, CD62P

UniProt

P16109

Expression Region

42-771aa

Tag

C-terminal hFc1-Myc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

108.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

WTYHYSTKAYSWNISRKYCQNRYTDLVAIQNKNEIDYLNKVLPYYSSYYWIGIRKNNKTWTWVGTKKALTNEAENWADNEPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTASCQDMSCSKQGECLETIGNYTCSCYPGFYGPECEYVRECGELELPQHVLMNCSHPLGNFSFNSQCSFHCTDGYQVNGPSKLECLASGIWTNKPPQCLAAQCPPLKIPERGNMTCLHSAKAFQHQSSCSFSCEEGFALVGPEVVQCTASGVWTAPAPVCKAVQCQHLEAPSEGTMDCVHPLTAFAYGSSCKFECQPGYRVRGLDMLRCIDSGHWSAPLPTCEAISCEPLESPVHGSMDCSPSLRAFQYDTNCSFRCAEGFMLRGADIVRCDNLGQWTAPAPVCQALQCQDLPVPNEARVNCSHPFGAFRYQSVCSFTCNEGLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMTCVQPLGSSSYKSTCQFICDEGYSLSGPERLDCTRSGRWTDSPPMCEAIKCPELFAPEQGSLDCSDTRGEFNVGSTCHFSCDNGFKLEGPNNVECTTSGRWSATPPTCKGIASLPTPGLQCPALTTPGQGTMYCRHHPGTFGFNTTCYFGCNAGFTLIGDSTLSCRPSGQWTAVTPACRAVKCSELHVNKPIAMNCSNLWGNFSYGSICSFHCLEGQLLNGSAQTACQENGHWSTTVPTCQAGPLTIQEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal AIPL1 Antibody [DyLight 350]
NBP1-76953UV 0.1 mL

Rabbit Polyclonal AIPL1 Antibody [DyLight 350]

Sign In for Pricing
View Details
Mouse Leptin AssayLite™ Antibody (APC Conjugate)
11431-05061 5x 30 µg

Mouse Leptin AssayLite™ Antibody (APC Conjugate)

Sign In for Pricing
View Details
Lrp8 Antibody
GWB-MP784A 50 µg

Lrp8 Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal SUMO1 Antibody (003)
NBP2-90170-50ul 50 µL

Rabbit Monoclonal SUMO1 Antibody (003)

Sign In for Pricing
View Details
Human Probable G-protein coupled receptor 62 (GPR62) ELISA Kit
MBS280966-01 48 Tests

Human Probable G-protein coupled receptor 62 (GPR62) ELISA Kit

Sign In for Pricing
View Details
Human Probable G-protein coupled receptor 62 (GPR62) ELISA Kit
MBS280966-02 96 Tests

Human Probable G-protein coupled receptor 62 (GPR62) ELISA Kit

Sign In for Pricing
View Details