Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-18 (Il18)

This Recombinant Mouse Interleukin-18 (Il18) spans the amino acid sequence from region 1-192aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P70380

Expression Region

1-192aa

Tag

Tag-Free

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAAMSEDSCVNFKEMMFIDNTLYFIPEENGDLESDNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Salicylaldehyde Azine
TRC-S087500-1G 1 g

Salicylaldehyde Azine

Sign In for Pricing
View Details
Human RBMXL2 activation kit by CRISPRa
GA109098 1 Kit

Human RBMXL2 activation kit by CRISPRa

Sign In for Pricing
View Details
LZTS1 Mouse Monoclonal Antibody [Clone ID: OTI3D12]
CF810241 100 µg

LZTS1 Mouse Monoclonal Antibody [Clone ID: OTI3D12]

Sign In for Pricing
View Details
DPH3P1 (NM_080750) Human Over-expression Lysate
LC429956 20 µg

DPH3P1 (NM_080750) Human Over-expression Lysate

Sign In for Pricing
View Details
mu Crystallin (CRYM) Mouse Monoclonal Antibody [Clone ID: 6B3]
AM20873PU-N 50 µg

mu Crystallin (CRYM) Mouse Monoclonal Antibody [Clone ID: 6B3]

Sign In for Pricing
View Details
N-Phenylglycinonitrile
TRC-P327168-100G 100 g

N-Phenylglycinonitrile

Sign In for Pricing
View Details