Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-18 (Il18)

This Recombinant Mouse Interleukin-18 (Il18) spans the amino acid sequence from region 1-192aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P70380

Expression Region

1-192aa

Tag

Tag-Free

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAAMSEDSCVNFKEMMFIDNTLYFIPEENGDLESDNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Ovary
CS632771 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
FGFR2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5F7]
TA502829AM 100 µL

FGFR2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5F7]

Sign In for Pricing
View Details
WDR77 Rabbit Polyclonal Antibody
TA365154 100 µL

WDR77 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
EPHA8 Polyclonal Antibody
E-AB-90107-01 60 µL

EPHA8 Polyclonal Antibody

Sign In for Pricing
View Details
EPHA8 Polyclonal Antibody
E-AB-90107-02 120 µL

EPHA8 Polyclonal Antibody

Sign In for Pricing
View Details
EPHA8 Polyclonal Antibody
E-AB-90107-03 200 µL

EPHA8 Polyclonal Antibody

Sign In for Pricing
View Details