Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-18 (Il18)

This Recombinant Mouse Interleukin-18 (Il18) spans the amino acid sequence from region 1-192aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P70380

Expression Region

1-192aa

Tag

Tag-Free

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAAMSEDSCVNFKEMMFIDNTLYFIPEENGDLESDNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Survivin (Ab-34) Antibody
8B0578-AAT 50 µg

Survivin (Ab-34) Antibody

Sign In for Pricing
View Details
Alkaline Phosphatase Conjugated Rabbit Affinity Purified Antibody to Equine IgG,
AAF-531-1 1 mL

Alkaline Phosphatase Conjugated Rabbit Affinity Purified Antibody to Equine IgG,

Sign In for Pricing
View Details
RBM22 Rabbit Polyclonal Antibody
TA380776 100 µL

RBM22 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IBTK (Center) Rabbit Polyclonal Antibody
AP52138PU-N 400 µL

IBTK (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18/834), CF594 conjugate, 0.1mg/mL
BNC940834-100 1x 100 µL

Cytokeratin 18 (KRT18/834), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HERC5 Antibody
KC-2322-01 50 μL

HERC5 Antibody

Sign In for Pricing
View Details