Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-18 (Il18)

This Recombinant Mouse Interleukin-18 (Il18) spans the amino acid sequence from region 1-192aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P70380

Expression Region

1-192aa

Tag

Tag-Free

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

22.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAAMSEDSCVNFKEMMFIDNTLYFIPEENGDLESDNFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uncoated Rat LDLR (Low Density Lipoprotein Receptor) ELISA Kit
E-UNEL-R0099-01 5x 96 Tests

Uncoated Rat LDLR (Low Density Lipoprotein Receptor) ELISA Kit

Sign In for Pricing
View Details
Uncoated Rat LDLR (Low Density Lipoprotein Receptor) ELISA Kit
E-UNEL-R0099-02 15x 96 Tests

Uncoated Rat LDLR (Low Density Lipoprotein Receptor) ELISA Kit

Sign In for Pricing
View Details
Ugp2 Mouse Gene Knockout Kit (CRISPR)
KN518662 1 Kit

Ugp2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GFR alpha 3 (GFRA3) Chicken Polyclonal Antibody
AP33457PU-N 100 µg

GFR alpha 3 (GFRA3) Chicken Polyclonal Antibody

Sign In for Pricing
View Details
5,5-bis(2-Fluorophenyl)-5-hydroxyvaleric Acid
TRC-F489615-250MG 250 mg

5,5-bis(2-Fluorophenyl)-5-hydroxyvaleric Acid

Sign In for Pricing
View Details
Recombinant Human MBL2/MBL/COLEC1 Protein
PKSH031629-01 100 µg

Recombinant Human MBL2/MBL/COLEC1 Protein

Sign In for Pricing
View Details