Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterovirus A71 Genome polyprotein, partial

This Recombinant Enterovirus A71 Genome polyprotein, partial spans the amino acid sequence from region 1441-1497aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Genome polyprotein [Cleaved into, P3, Protein 3AB, P2, P1, Capsid protein VP0 (VP4-VP2), Capsid protein VP4 (P1A) (Virion protein 4), Capsid protein VP2 (P1B) (Virion protein 2), Capsid protein VP3 (P1C) (Virion protein 3), Capsid protein VP1 (P1D) (Virion protein 1), Protease 2A (P2A) (EC 3.4.22.29) (Picornain 2A) (Protein 2A), Protein 2B (P2B), Protein 2C (P2C) (EC 3.6.1.15), Protein 3A (P3A), Viral protein genome-linked (VPg) (Protein 3B) (P3B), Protein 3CD (EC 3.4.22.28), Protease 3C (P3C), RNA-directed RNA polymerase (RdRp) (EC 2.7.7.48) (3D polymerase) (3Dpol) (Protein 3D) (3D) ]

UniProt

F6KTB0

Expression Region

1441-1497aa

Tag

Tag-Free

Source

E.coli

Origin

Enterovirus A71

Field of Research

Epigenetics, Infectious Diseases

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

6.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GPPKFKPIKISLEEKPAPDAISDLLASVDSEEVRQYCRDQGWIIPETPTNVERHLNR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TXNDC14 shRNA (h) Lentiviral Particles
sc-96757-V 200 µL

TXNDC14 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
Aminoallyl-dUTP-ATTO-Rho11
orb64144 40 µL

Aminoallyl-dUTP-ATTO-Rho11

Sign In for Pricing
View Details
Agomelatine 100mg
A10048-100 100 mg

Agomelatine 100mg

Sign In for Pricing
View Details
UFD1 Human siRNA Oligo Duplex (Locus ID 7353)
SR305021 1 Kit

UFD1 Human siRNA Oligo Duplex (Locus ID 7353)

Sign In for Pricing
View Details
Intermedin, Human (IMD, Adrenomedullin-2, AM-2)
302020 100 µg

Intermedin, Human (IMD, Adrenomedullin-2, AM-2)

Sign In for Pricing
View Details
Phospho-heterochromatin protein 1 (pTyr24) Rabbit pAb
E47R0928 100 µL

Phospho-heterochromatin protein 1 (pTyr24) Rabbit pAb

Sign In for Pricing
View Details