Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Claudin-1 (Cldn1), partial

This Recombinant Rat Claudin-1 (Cldn1), partial spans the amino acid sequence from region 29-81aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Claudin-1

UniProt

P56745

Expression Region

29-81aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTGQIQCKVFDSLLNLNSTLQATR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Fluoro-2-nitrobenzotrifluoride
TRC-F594600-25G 25 g

5-Fluoro-2-nitrobenzotrifluoride

Sign In for Pricing
View Details
Heregulin-1 / Neuregulin-1 (Breast and Urothelial Marker) (NRG1/2752), CF640R conjugate, 0.1mg/mL
BNC402752-500 1x 500 µL

Heregulin-1 / Neuregulin-1 (Breast and Urothelial Marker) (NRG1/2752), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: bilateral
CS631593 5x 5 µm

Frozen Tissue Sections, Ovary: bilateral

Sign In for Pricing
View Details
CDX2 / Caudal Type Homeobox 2 (GI Epithelial Marker) (CDX2/2214), CF405S conjugate, 0.1mg/mL
BNC042214-500 1x 500 µL

CDX2 / Caudal Type Homeobox 2 (GI Epithelial Marker) (CDX2/2214), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IP/CoIP Kit (Pro A Agarose)
EA-IP-K006 50 Tests

IP/CoIP Kit (Pro A Agarose)

Sign In for Pricing
View Details
BRDT Human Gene Knockout Kit (CRISPR)
KN422276 1 Kit

BRDT Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details