Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Claudin-1 (Cldn1), partial

This Recombinant Rat Claudin-1 (Cldn1), partial spans the amino acid sequence from region 29-81aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Claudin-1

UniProt

P56745

Expression Region

29-81aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QWKIYSYAGDNIVTAQAIYEGLWMSCVSQSTGQIQCKVFDSLLNLNSTLQATR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGF beta Receptor III (TGFBR3) Human Gene Knockout Kit (CRISPR)
KN216595 1 Kit

TGF beta Receptor III (TGFBR3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tstd1 Mouse Gene Knockout Kit (CRISPR)
KN518386 1 Kit

Tstd1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RPS6KC1 Polyclonal Antibody
E-AB-90681-01 60 µL

RPS6KC1 Polyclonal Antibody

Sign In for Pricing
View Details
RPS6KC1 Polyclonal Antibody
E-AB-90681-02 120 µL

RPS6KC1 Polyclonal Antibody

Sign In for Pricing
View Details
RPS6KC1 Polyclonal Antibody
E-AB-90681-03 200 µL

RPS6KC1 Polyclonal Antibody

Sign In for Pricing
View Details
CD130 (IL6ST) (NM_002184) Human Over-expression Lysate
LY400797 100 µg

CD130 (IL6ST) (NM_002184) Human Over-expression Lysate

Sign In for Pricing
View Details