Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human papillomavirus 11 Protein E6 (E6)

This Recombinant Human papillomavirus 11 Protein E6 (E6) spans the amino acid sequence from region 1-150aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein E6

UniProt

P04019

Expression Region

1-150aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Human papillomavirus 11

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MESKDASTSATSIDQLCKTFNLSLHTLQIQCVFCRNALTTAEIYAYAYKNLKVVWRDNFPFAACACCLELQGKINQYRHFNYAAYAPTVEEETNEDILKVLIRCYLCHKPLCEIEKLKHILGKARFIKLNNQWKGRCLHCWTTCMEDLLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM98A Peptide - middle region (AAP55264)
AAP55264-100UG 100 µg

FAM98A Peptide - middle region (AAP55264)

Sign In for Pricing
View Details
Anti-Zebrafish SEPHS1 Antibody Picoband®
AZQ7ZW38-carrier-free 100 µg/Vial

Anti-Zebrafish SEPHS1 Antibody Picoband®

Sign In for Pricing
View Details
Nori® Sheep S100A12 ELISA Kit
GR116319 96 Well

Nori® Sheep S100A12 ELISA Kit

Sign In for Pricing
View Details
Galectin 10 Rabbit Polyclonal Antibody (BF680)
orb2526299 100 µL

Galectin 10 Rabbit Polyclonal Antibody (BF680)

Sign In for Pricing
View Details
Mouse Monoclonal NKp46/NCR1 Antibody (B-L46) [Alexa Fluor 350]
NBP3-14597AF350 0.1 mL

Mouse Monoclonal NKp46/NCR1 Antibody (B-L46) [Alexa Fluor 350]

Sign In for Pricing
View Details
Thbs2 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4343302 1.0 µg DNA

Thbs2 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details