Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human papillomavirus 11 Protein E6 (E6)

This Recombinant Human papillomavirus 11 Protein E6 (E6) spans the amino acid sequence from region 1-150aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein E6

UniProt

P04019

Expression Region

1-150aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Human papillomavirus 11

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MESKDASTSATSIDQLCKTFNLSLHTLQIQCVFCRNALTTAEIYAYAYKNLKVVWRDNFPFAACACCLELQGKINQYRHFNYAAYAPTVEEETNEDILKVLIRCYLCHKPLCEIEKLKHILGKARFIKLNNQWKGRCLHCWTTCMEDLLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-LYRIC Monoclonal Antibody
M04060 100 µL/Vial

Anti-LYRIC Monoclonal Antibody

Sign In for Pricing
View Details
Anti-DDX59 Antibody Picoband® Fluoro647 Conjugated
A12681-1-Fluoro647 100 µg/Vial

Anti-DDX59 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
CCNI2, ID (CCNI2, Cyclin-I2) (APC) discontinued
033416-APC 200 µL

CCNI2, ID (CCNI2, Cyclin-I2) (APC) discontinued

Sign In for Pricing
View Details
GRIA4 (NM_000829) Human Untagged Clone
SC119639 10 µg

GRIA4 (NM_000829) Human Untagged Clone

Sign In for Pricing
View Details
Slc39a6 (NM_001024745) Rat Tagged Lenti ORF Clone
RR206091L4 10 µg

Slc39a6 (NM_001024745) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
IgG, H&L, X-Adsorbed (AP)
I1904-40B 1 mg

IgG, H&L, X-Adsorbed (AP)

Sign In for Pricing
View Details