Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor susceptibility gene 101 protein (TSG101), partial

This Recombinant Human Tumor susceptibility gene 101 protein (TSG101), partial spans the amino acid sequence from region 1-145aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tumor susceptibility gene 101 protein (ESCRT-I complex subunit TSG101)

UniProt

Q99816

Expression Region

1-145aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMPD1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
44466124 3x 1.0µg DNA

SMPD1 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
CRLS1 (C20orf155, Cardiolipin synthase, Cardiolipin synthase 1, CLS, CLS1, DJ967N21.6, GCD10)
208093 100 µg

CRLS1 (C20orf155, Cardiolipin synthase, Cardiolipin synthase 1, CLS, CLS1, DJ967N21.6, GCD10)

Sign In for Pricing
View Details
Acetyl-Histone H3 (Lys37) Rabbit Polyclonal Antibody
AG3931 50 µL

Acetyl-Histone H3 (Lys37) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DNAJB7 Antibody Blocking peptide
orb1456874 500 µg

DNAJB7 Antibody Blocking peptide

Sign In for Pricing
View Details
Rabbit Anti KDM6A Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (IHC) 120ul
IRBAMLKDM6AAP874120UL 120 µL

Rabbit Anti KDM6A Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (IHC) 120ul

Sign In for Pricing
View Details
DDX11L16 ORF Vector (Human) (pORF)
ORF018116 1.0 µg DNA

DDX11L16 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details