Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Asialoglycoprotein receptor 1 (Asgr1), partial

This Recombinant Rat Asialoglycoprotein receptor 1 (Asgr1), partial spans the amino acid sequence from region 61-284aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Asialoglycoprotein receptor 1 (ASGP-R 1) (ASGPR 1) (Hepatic lectin 1) (HL-1) (rHL-1)

UniProt

P02706

Expression Region

61-284aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QNSQLREDLRVLRQNFSNFTVSTEDQVKALTTQGERVGRKMKLVESQLEKHQEDLREDHSRLLLHVKQLVSDVRSLSCQMAALRGNGSERICCPINWVEYEGSCYWFSSSVKPWTEADKYCQLENAHLVVVTSWEEQRFVQQHMGPLNTWIGLTDQNGPWKWVDGTDYETGFKNWRPGQPDDWYGHGLGGGEDCAHFTTDGHWNDDVCRRPYRWVCETELGKAN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1424 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4214408 1.0 µg DNA

Olfr1424 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
FAS (Fas (TNF Receptor Superfamily, Member 6), ALPS1A, APO-1, APT1, CD95, FAS1, FASTM, TNFRSF6) (PE)
245981-PE 100 µL

FAS (Fas (TNF Receptor Superfamily, Member 6), ALPS1A, APO-1, APT1, CD95, FAS1, FASTM, TNFRSF6) (PE)

Sign In for Pricing
View Details
Lentiviral human VDAC2 shRNA (UAS) - Lentiviral human VDAC2 shRNA (UAS, GFP) (25)
GTR15309515 1 Vial

Lentiviral human VDAC2 shRNA (UAS) - Lentiviral human VDAC2 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
TEM7 (Tumor Endothelial Marker 7, Plexin Domain Containing 1, Plexin Domain-containing Protein 1 Precursor, PLXDC1, Tumor Endothelial Marker 3, TEM3) (MaxLight 405) discontinued
T2500-01B-ML405 100 µL

TEM7 (Tumor Endothelial Marker 7, Plexin Domain Containing 1, Plexin Domain-containing Protein 1 Precursor, PLXDC1, Tumor Endothelial Marker 3, TEM3) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Box of 100 Folded Slow Qualitative Filter, 185 Mm
QL04P0185C Box of 100

Box of 100 Folded Slow Qualitative Filter, 185 Mm

Sign In for Pricing
View Details
EID3 (EP300 interacting inhibitor of differentiation 3) discontinued
314546 100 µL

EID3 (EP300 interacting inhibitor of differentiation 3) discontinued

Sign In for Pricing
View Details