Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Avian infectious bronchitis virus Non-structural protein 3b (3b)

This Recombinant Avian infectious bronchitis virus Non-structural protein 3b (3b) spans the amino acid sequence from region 1-64aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Non-structural protein 3b (ns3b) (Accessory protein 3b)

UniProt

P30241

Expression Region

1-64aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Avian infectious bronchitis virus (strain Beaudette) (IBV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

8.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLNLEVIIETGEQVIQKISFNLQHISSVLNTEVFDPFDYCYYRGGNFWEIESAEDCSGDDEFIE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C18orf12 sgRNA CRISPR Lentivector (Human) (Target 1)
K0323502 1.0 µg DNA

C18orf12 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
GFAP Ser38 Rabbit Polyclonal Antibody
E53P04182 100 µL

GFAP Ser38 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human MLKL Pre-designed siRNA Set A
SI009637A 1 Each

Human MLKL Pre-designed siRNA Set A

Sign In for Pricing
View Details
LW1/HSFX1 Polyclonal Antibody, RBITC Conjugated
bs-18448R-RBITC 100 µL

LW1/HSFX1 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
SCNG-15-3 ClipSleeve Markers
333903 300 Pack (30 Sleeve (s) x 10 Wand)

SCNG-15-3 ClipSleeve Markers

Sign In for Pricing
View Details
CREG1 Rabbit Polyclonal Antibody
orb2952993-01 50 µg

CREG1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details