Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Avian infectious bronchitis virus Non-structural protein 3b (3b)

This Recombinant Avian infectious bronchitis virus Non-structural protein 3b (3b) spans the amino acid sequence from region 1-64aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Non-structural protein 3b (ns3b) (Accessory protein 3b)

UniProt

P30241

Expression Region

1-64aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Avian infectious bronchitis virus (strain Beaudette) (IBV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

8.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLNLEVIIETGEQVIQKISFNLQHISSVLNTEVFDPFDYCYYRGGNFWEIESAEDCSGDDEFIE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP6V1E1 Protein Vector (Human) (pPM-C-HA)
PV003215 500 ng

ATP6V1E1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Brilliant Violet 650™ anti-human CD62L
GT08138 25 Tests

Brilliant Violet 650™ anti-human CD62L

Sign In for Pricing
View Details
Recombinant Human RAMP1 Protein, N-GST & C-His
YHB03601 100 μg

Recombinant Human RAMP1 Protein, N-GST & C-His

Sign In for Pricing
View Details
Anti-Filarial nematode worm BmVal-1 Antibody, PE Conjugate
DZ41600-PE 200 µL/Vial

Anti-Filarial nematode worm BmVal-1 Antibody, PE Conjugate

Sign In for Pricing
View Details
LAMB3 Recombinant Protein
OPCD04819-50UG 50 µg

LAMB3 Recombinant Protein

Sign In for Pricing
View Details
Tyr-Bradykinin
orb372890-01 1 mg

Tyr-Bradykinin

Sign In for Pricing
View Details