Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Avian infectious bronchitis virus Non-structural protein 3b (3b)

This Recombinant Avian infectious bronchitis virus Non-structural protein 3b (3b) spans the amino acid sequence from region 1-64aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Non-structural protein 3b (ns3b) (Accessory protein 3b)

UniProt

P30241

Expression Region

1-64aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Avian infectious bronchitis virus (strain Beaudette) (IBV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

8.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLNLEVIIETGEQVIQKISFNLQHISSVLNTEVFDPFDYCYYRGGNFWEIESAEDCSGDDEFIE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOR siRNA (Mouse)
orb1846916-01 15 nmol

LOR siRNA (Mouse)

Sign In for Pricing
View Details
LOR siRNA (Mouse)
orb1846916-02 30 nmol

LOR siRNA (Mouse)

Sign In for Pricing
View Details
Lentiviral mouse Med23 shRNA (UAS) - Lentiviral mouse Med23 shRNA (UAS, iRFP) (25)
GTR15135398 1 Vial

Lentiviral mouse Med23 shRNA (UAS) - Lentiviral mouse Med23 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Chicken Sphingomyelin Synthase 1 (SGMS1) ELISA Kit
MBS9938561 Inquire

Chicken Sphingomyelin Synthase 1 (SGMS1) ELISA Kit

Sign In for Pricing
View Details
Presto™ DNA/RNA/Protein Extraction Kit - Individual Packed Columns
DRP050 each

Presto™ DNA/RNA/Protein Extraction Kit - Individual Packed Columns

Sign In for Pricing
View Details
DAZL (NM_001190811) Human Over-expression Lysate
LY434157 100 µg

DAZL (NM_001190811) Human Over-expression Lysate

Sign In for Pricing
View Details