Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cartilage matrix protein (MATN1)

This Recombinant Human Cartilage matrix protein (MATN1) spans the amino acid sequence from region 23-496aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cartilage matrix protein (Matrilin-1)

UniProt

P21941

Expression Region

23-496aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

57.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPGLAPQSRGHLCRTRPTDLVFVVDSSRSVRPVEFEKVKVFLSQVIESLDVGPNATRVGMVNYASTVKQEFSLRAHVSKAALLQAVRRIQPLSTGTMTGLAIQFAITKAFGDAEGGRSRSPDISKVVIVVTDGRPQDSVQDVSARARASGVELFAIGVGSVDKATLRQIASEPQDEHVDYVESYSVIEKLSRKFQEAFCVVSDLCATGDHDCEQVCISSPGSYTCACHEGFTLNSDGKTCNVCSGGGGSSATDLVFLIDGSKSVRPENFELVKKFISQIVDTLDVSDKLAQVGLVQYSSSVRQEFPLGRFHTKKDIKAAVRNMSYMEKGTMTGAALKYLIDNSFTVSSGARPGAQKVGIVFTDGRSQDYINDAAKKAKDLGFKMFAVGVGNAVEDELREIASEPVAEHYFYTADFKTINQIGKKLQKKICVEEDPCACESLVKFQAKVEGLLQALTRKLEAVSKRLAILENTVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LMO7 (LIM Domain only Protein 7, LMO-7, F-box only Protein 20, LOMP, LMO7, FBX20, FBXO20, KIAA0858) (FITC) discontinued
302533-FITC 200 µL

LMO7 (LIM Domain only Protein 7, LMO-7, F-box only Protein 20, LOMP, LMO7, FBX20, FBXO20, KIAA0858) (FITC) discontinued

Sign In for Pricing
View Details
Recombinant Human NGAL/Lipocalin-2/LCN2 (C-6His, Human Cells)
orb1648753-01 10 µg

Recombinant Human NGAL/Lipocalin-2/LCN2 (C-6His, Human Cells)

Sign In for Pricing
View Details
Recombinant Human NGAL/Lipocalin-2/LCN2 (C-6His, Human Cells)
orb1648753-02 50 µg

Recombinant Human NGAL/Lipocalin-2/LCN2 (C-6His, Human Cells)

Sign In for Pricing
View Details
Recombinant Human NGAL/Lipocalin-2/LCN2 (C-6His, Human Cells)
orb1648753-03 500 µg

Recombinant Human NGAL/Lipocalin-2/LCN2 (C-6His, Human Cells)

Sign In for Pricing
View Details
Recombinant Human NGAL/Lipocalin-2/LCN2 (C-6His, Human Cells)
orb1648753-04 1 mg

Recombinant Human NGAL/Lipocalin-2/LCN2 (C-6His, Human Cells)

Sign In for Pricing
View Details
MINERALEOLIE355X37CARD-T1-P18 Pipe Markers for Other Liquids
N005292 3 Card (3 Marker (s) x 1 Card)

MINERALEOLIE355X37CARD-T1-P18 Pipe Markers for Other Liquids

Sign In for Pricing
View Details