Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Zinc finger protein GLI1 (GLI1), partial

This Recombinant Human Zinc finger protein GLI1 (GLI1), partial spans the amino acid sequence from region 201-400aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Zinc finger protein GLI1 (Glioma-associated oncogene) (Oncogene GLI)

UniProt

P08151

Expression Region

201-400aa

Tag

N-terminal 6xHis-tagged and C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SPNSTGIQDPLLGMLDGREDLEREEKREPESVYETDCRWDGCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMRRHTGEKPHKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEHEGCSKAFSNASDRAKHQNRTHSNEKPYVCKLPGCTKRYTDPSSLRKHVKTVHGPDAHVTKRHRGD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rfx5 Mouse Gene Knockout Kit (CRISPR)
KN514709 1 Kit

Rfx5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ANXA11 Antibody (Biotin)
KB-7520-01 50 μL

ANXA11 Antibody (Biotin)

Sign In for Pricing
View Details
ANXA11 Antibody (Biotin)
KB-7520-02 100 µL

ANXA11 Antibody (Biotin)

Sign In for Pricing
View Details
ANXA11 Antibody (Biotin)
KB-7520-03 1 mL

ANXA11 Antibody (Biotin)

Sign In for Pricing
View Details
Synaptojanin (SYNJ1) (NM_203446) Human Recombinant Protein
TP315278M 100 µg

Synaptojanin (SYNJ1) (NM_203446) Human Recombinant Protein

Sign In for Pricing
View Details
Human FETUB Antibody Pair Set
E-KAB-0459 50 µL & 100 µg

Human FETUB Antibody Pair Set

Sign In for Pricing
View Details