Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 5-hydroxytryptamine receptor 1D (HTR1D), partial

This Recombinant Human 5-hydroxytryptamine receptor 1D (HTR1D), partial spans the amino acid sequence from region 1-38aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

5-hydroxytryptamine receptor 1D (5-HT-1D) (5-HT1D) (Serotonin 1D alpha receptor) (5-HT-1D-alpha) (Serotonin receptor 1D)

UniProt

P28221

Expression Region

1-38aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant HPV-57 L2 (aa 1-465) Protein
VAng-Wyb3332-500gEcoli 500 µg (E. coli)

Recombinant HPV-57 L2 (aa 1-465) Protein

Sign In for Pricing
View Details
Β-Glucuronidase from Bovine Liver
B2014797 25 KU

Β-Glucuronidase from Bovine Liver

Sign In for Pricing
View Details
Exportin 1 Rabbit pAb
E47R10151 100 µL

Exportin 1 Rabbit pAb

Sign In for Pricing
View Details
TRNAQ3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
48300111 3x 1.0 µg

TRNAQ3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
TIRAP sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2376908 1.0 µg DNA

TIRAP sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Dog/Canine Krebs Von Den Lungen 6 KL-6 ELISA Kit
BG-CAN11453 1 Each

Dog/Canine Krebs Von Den Lungen 6 KL-6 ELISA Kit

Sign In for Pricing
View Details